New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Peptides
Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.
Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.
TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.
OXM(1-37)-biotin
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
| Chemical | |
|---|---|
| CAS # | 1802086-70-9 |
| Form | Lyophilized |
| Molecular Formula | C165H252N44O48S |
| Molecular Weight | 3256.3 |
| Purity | >95% by HPLC |
| Reconstitution | 1.10 mM; ultrasonic and adjust pH to 3 with HCl |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-(K-Biotin}-NH2ah |
| Solubility | H2O : 4 mg/mL |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |
