New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Peptides
Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.
Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.
TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.
OXM(1-37)
Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence.
| Chemical | |
|---|---|
| CAS # | 62340-29-8 |
| Form | Lyophilized |
| Molecular Formula | C192H295N59O60S |
| Molecular Weight | 4421.86 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH |
| Solubility | Soluble to 1.10 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |
