Image

New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Peptides

Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.

Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.

TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.

Image
Product Code: TDP-8105

Price: $429.00

Available Options

* Size:
- +

Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence.

Chemical
CAS # 62340-29-8
Form Lyophilized
Molecular Formula C192H295N59O60S
Molecular Weight 4421.86
Purity >95% by HPLC
Reconstitution Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO.
Sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
Solubility Soluble to 1.10 mg/ml in water
Shipping and Handling
Storage Condition Store at -20°C
Image

Phone: +1 (619) 363-7998

Office: 9636 TIERRA GRANDE ST, STE 104,
San Diego, CA 92126

Services

Products

Support

Follow Us at

  • Item 2
Image