Image

New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Peptides

Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.

Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.

TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.

Image
Product Code: TDP-8110

Price: $99.00

Available Options

* Size:
- +

Glucagon-Like Peptide-1 (7-37) is a naturally occurring, biologically active form of GLP-1, a hormone derived from the proglucagon gene. It consists of 31 amino acids and plays a key role in glucose homeostasis. GLP-1 (7-37) stimulates insulin secretion in a glucose-dependent manner, inhibits glucagon release, slows gastric emptying, and reduces appetite, making it important in the regulation of blood sugar levels and a target for type 2 diabetes and obesity treatments.

Chemical
CAS # CAS 106612-94-6
Form Lyophilized
Molecular Formula C151H228N40O47
Molecular Weight 3355.9 g/mol
Purity >95% by HPLC
Reconstitution Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with DMSO.
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility Soluble to 1 mg/ml in water
Shipping and Handling
Storage Condition Store at -20°C
Image

Phone: +1 (619) 363-7998

Office: 9636 TIERRA GRANDE ST, STE 104,
San Diego, CA 92126

Services

Products

Support

Follow Us at

  • Item 2
Image