Image

New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Peptides

Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.

Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.

TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.

Image
Product Code: TDP-4220

Price: $199.00

Available Options

* Size:
- +

GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits

Chemical
CAS # 100040-31-1
Form Lyophilized
Molecular Formula C226H338N60O66S
Molecular Weight 4983.58
Purity >95% by HPLC
Reconstitution Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO.
Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Solubility Soluble to 1 mg/ml in water
Shipping and Handling
Storage Condition Store at -20°C
Image

Phone: +1 (619) 363-7998

Office: 9636 TIERRA GRANDE ST, STE 104,
San Diego, CA 92126

Services

Products

Support

Follow Us at

  • Item 2
Image